PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 343aa    MW: 38242.6 Da    PI: 6.456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031850genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l  +    G g+W+ +ar  g+ R++k+c++rw +yl
      Lus10031850 21 KGLWSPEEDEKLMSYMMTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding42.12.1e-1374121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...TTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg...kgRtlkqcksrwqk 46 
                      rg+++++E+el+v+++ +lG++ W+ Ia+ +     gRt++++k++w++
      Lus10031850  74 RGAFSPQEEELIVHLHSLLGNR-WSQIAAPFAarlPGRTDNEIKNFWNS 121
                      89********************.****987777777***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.2821672IPR017930Myb domain
SuperFamilySSF466895.72E-2619119IPR009057Homeodomain-like
SMARTSM007174.5E-112070IPR001005SANT/Myb domain
PfamPF002496.8E-142168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-232275IPR009057Homeodomain-like
CDDcd001671.16E-92468No hitNo description
SMARTSM007176.6E-1273125IPR001005SANT/Myb domain
PROSITE profilePS5129416.90973127IPR017930Myb domain
PfamPF002491.0E-1174121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2376128IPR009057Homeodomain-like
CDDcd001671.93E-976123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MRKPAEPTSG NTTTAMVKLR KGLWSPEEDE KLMSYMMTNG QGCWSDVARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEELIVHLHS LLGNRWSQIA APFAARLPGR TDNEIKNFWN  120
STVKKRLKNI QSSSASPNTS DSSSDHQPVG SKDHNAMMGL SSSSPSNFLP PPMFLVDPSL  180
TSTTTTNHTM DPNSSQILDH HPNHHHGLMM NNMYGANNLS SYFDSHMASN IPPSRMGSEQ  240
GMFVVGGDGG GCGNGELQVI PPLMEETMNG ANDTNLTTNC NNNKYPFVNS YTIKEEISDT  300
NLGNYWQGDH HHHHHQDRVG EWDFEELMKD VSCFPFLDFQ VE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25191275108B-MYB
1h8a_C1e-241912725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8874621e-103HQ887462.1 Linum usitatissimum clone GMU2AYZ01BW4NE microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025528.12e-96PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV22e-68MYB46_ARATH; Transcription factor MYB46
TrEMBLS5XGT41e-95S5XGT4_POPTR; MYB transcription factor
STRINGPOPTR_0009s05860.12e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-68myb domain protein 46